GenomeNet

>drm:Dred_2844 glycerol 3-phosphate dehydrogenase (quinone) subunit A (EC:1.1.5.3); K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MTTDRAQVVVIGGGATGTGILRDLALRGISGILVEQGDLAHGTSSRFHGLLHSGARYAVK
DKEAARECIEENMILRKIAPNCVEETGGLFVQLKEDDPSYTDKWISSCAQAGIPTEEVEI
GELRRTYPVLSPDIVRAFRVPDCAVDGFRVLWSNVNSARQYGGQVLTYHKLIGIKQSNGK
ICGVEVANQLTGEHKYIECQLVINAAGAWAGEVAAMAGLEVNVIKDKGTLVAYNHRLTNQ
VVNRLRPPGDGDIFVPHGTITILGTTSITVDEPSCSKPGQQEVLDLIKIGSEMIPELQNF
RMIRAFAGVRPLYQAGNGAVGRAVTRNFALLDHQQQDGLNGLVSIVGGKFTTFRLMAEKT
VDMAAQKLGVDAPSRTAEEPLTNPISKEILERGKKVFGVAGAKKAADRLGDNFVKVLEEA
EKEPHKCKVFCECEAVSLAEIDFVARDGDSFTLGDIRRKTRLGMGTCQGTFCSYRTLGAL
SSYDWTRNHKEFLTKFLQKRWKGIRPVMWGQQMREAQLSTAIYCTLFGMERMK

BLAST