GenomeNet

>drm:Dred_2844 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (GenBank) glycerol 3-phosphate dehydrogenase (quinone) subunit A (A)
MTTDRAQVVVIGGGATGTGILRDLALRGISGILVEQGDLAHGTSSRFHGLLHSGARYAVK
DKEAARECIEENMILRKIAPNCVEETGGLFVQLKEDDPSYTDKWISSCAQAGIPTEEVEI
GELRRTYPVLSPDIVRAFRVPDCAVDGFRVLWSNVNSARQYGGQVLTYHKLIGIKQSNGK
ICGVEVANQLTGEHKYIECQLVINAAGAWAGEVAAMAGLEVNVIKDKGTLVAYNHRLTNQ
VVNRLRPPGDGDIFVPHGTITILGTTSITVDEPSCSKPGQQEVLDLIKIGSEMIPELQNF
RMIRAFAGVRPLYQAGNGAVGRAVTRNFALLDHQQQDGLNGLVSIVGGKFTTFRLMAEKT
VDMAAQKLGVDAPSRTAEEPLTNPISKEILERGKKVFGVAGAKKAADRLGDNFVKVLEEA
EKEPHKCKVFCECEAVSLAEIDFVARDGDSFTLGDIRRKTRLGMGTCQGTFCSYRTLGAL
SSYDWTRNHKEFLTKFLQKRWKGIRPVMWGQQMREAQLSTAIYCTLFGMERMK

BLAST