GenomeNet

>dru:Desru_1852 no KO assigned | (GenBank) DNA polymerase LigD, ligase domain protein (A)
MRQEKELPNLKPMLAVKAAPFDSDDYLYEIKWDGYRALAYLNQQTLLYSRNQLDLTKSFP
DLQGLHLRVKQKPLILDGEIVVLKDGKPSFSALQSRGKLSDPLKIRRLCQQNPATFVVFD
VLFSNGRNLMNLPLLQRKKFLEEMAEQGPDLIVSQYVLGSGCEFFRVVKAAGLEGMVAKR
LDSPYLPGKRSGYWKKIRWVQSADLVICGWEKGEGQRLLGALILGVPEKGGWVYMGKVGT
GFSREEEKRIITLLKPLEGHPPFSSLPDEDFRKTVWVCPELVCEVTFSEISPEGRLRHPS
YKGLRKDKKAEECGHL

BLAST