GenomeNet

>dru:Desru_1852 DNA polymerase LigD ligase domain-containing protein (A)
MRQEKELPNLKPMLAVKAAPFDSDDYLYEIKWDGYRALAYLNQQTLLYSRNQLDLTKSFP
DLQGLHLRVKQKPLILDGEIVVLKDGKPSFSALQSRGKLSDPLKIRRLCQQNPATFVVFD
VLFSNGRNLMNLPLLQRKKFLEEMAEQGPDLIVSQYVLGSGCEFFRVVKAAGLEGMVAKR
LDSPYLPGKRSGYWKKIRWVQSADLVICGWEKGEGQRLLGALILGVPEKGGWVYMGKVGT
GFSREEEKRIITLLKPLEGHPPFSSLPDEDFRKTVWVCPELVCEVTFSEISPEGRLRHPS
YKGLRKDKKAEECGHL

BLAST