GenomeNet

>dse:Dsec_GM20899 K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] | (RefSeq) Dsec\GM20899-PA (A)
MLATEARQILIRVGSLVARNQMRAISNGTAQLEQQAQPKEAQEPQIKKFEIYRWNPDNAG
EKPYMQTYEVDLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLAC
ISKIDINTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKNEAGEKKGKAQYL
QSVEDRSKLDGLYECILCACCSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDENSAERL
NKLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLASKPAPKLETAALHK

BLAST