GenomeNet

>dse:Dsec_GM20899 GM20899 gene product from transcript GM20899-RA; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MLATEARQILIRVGSLVARNQMRAISNGTAQLEQQAQPKEAQEPQIKKFEIYRWNPDNAG
EKPYMQTYEVDLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLAC
ISKIDINTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKNEAGEKKGKAQYL
QSVEDRSKLDGLYECILCACCSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDENSAERL
NKLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLASKPAPKLETAALHK

BLAST