GenomeNet

>dse:Dsec_GM21150 K13803 transient-receptor-potential-like protein | (RefSeq) GM21150 gene product from transcript GM21150-RA (A)
MGRKKKLPTGVSSGGSHASSAPKSVGGCCVPLGLPQPLLLEEKKFLLAVERGDMPNVRRI
LQKALRHQHININCMDPLGRRALTLAIDNENLEMVELLVVMGVETKDALLHAINAEFVEA
VELLLEHEELIYKEGEPYSWQKVDINTAMFAPDITPLMLAAHKNNFEILRILLDRGAAVP
VPHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSNDPIITAFQLSWELRN
LALTEQECKSEYMDLRRQCQKFAVDLLDQTRTSNELAIILNYDPQMSSYEPGDRMSLTRL
VQAISYKQKKFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICIAQVAVLFPLYCLIYMC
APNCRTGQLMRKPFMKFLIHASSYLFFLFILILVSQRADDDFVRIFGTTRMKKELAEQEL
RQRGQTPSKLELIVVLYVIGFVWEEVQEIFAVGMKSYLRNMWNFIDFLRNSLYVSVMCLR
AFAYIQQATEIARDPQMAYIPREKWHDFDPQLIAEGLFAAANVFSALKLVHLFSINPHLG
PLQISLGRMVIDIVKFFFIYTLVLFAFACGLNQLLWYFAALEKSKCYVLPGGEADWGSHG
DSCMKWRRFGNLFESSQSLFWASFGMVGLDDFELSGIKSYTRFWGLLMFGSYSVINVIVL
LNLLIAMMSNSYAMIDEHSDTEWKFARTKLWMSYFEDSATLPPPFNVLPSVKWVIRIFRK
SSKTIDRQRSKKRKEQEQFSEYDNIMRSLVWRYVAAMHRKFEDNPVSEDDINEVKSEINT
MRYEMLEIFENSGMDVSSANKKERQPRPRRIKVWERRLMKGFQVAPVQNGCEPDAFGNVN
GQGEMREIKVESIPSKPAKETAKERFQRVARTVLLQSTAHKWNVVLRAAKDSQIGRCTKN
EQKSLQNLGRAIEEAKRLIMLNPGCPSGRESPIRIEFEDEKTSTLLELLNQISAEISDSE
KPKIRPTWRPPLKTVPARAMAANNTRSLTAPELKISRKSSPAPTPTPTPGVSHTALSQFR
NRELPLCPSKLIANSAPAAPTAPPKKSEPTAAPPTYKPTTHAPFSVEGGNRGNTRTSDGV
RSDNSNFDIHVVDLDEKGGHLGRDNVSDISSIASTSPQRPKHRN

BLAST