GenomeNet

>dsi:Dsim_GD12763 GD12763 gene product from transcript GD12763-RA; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MNRLFVRRAGQHVTRSLFGPNASRLPQVTCVRDACCKDEYSLIDHKFDAIVIGAGGAGMR
AGFGLAEKGFQTAIISKLFPTRSHTVAAQGGVNAALSNMDKDDWKYHFYDTVKGSDWLGD
QNAIHYMCREAEKAVCELDISHGHALIHTLYGQTLKHSDSCHYFVDYFVLDLIMSQGACV
GCLAWKLDDGTFHRFLAKNTVVAAGGCGRVYFSTTAGHTCTGDGNAWVSRQELPLMDMEF
VQFHPTGIYGAGCLITEGVRGEGGFFLNCKGERFMERYAPKAKDLASRDVVARAMTMEVL
AGNGCGPLKDHVHLQLHHIDAKIIKQRLPGIMVTARIFAKVDVTKEPVPVLPTVHYNMGG
IPTDYKGRVVTIDENGKEQVVKGLYSCGETSCASVHGANRLGANSLLDLIIFGRVCALDI
AANSCPGDKPPQVEDKATEKSLDNFKRLRCADGCIPTAALRMELQRTMTKHAAVFREGKL
LKEGLLKVAELCEQFKDIKTTDRTMVWNSNLVETLELQNMLANAVHIITAMENRKESRGS
HAREDFKTRVDELDYGAPLAGQKKKPFEEHWRKHTMTFALGNKGCASIKYRPVVDTTLDS
SVAPIPPAPRTY

BLAST