GenomeNet

>dsi:Dsimw501_GD12763 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) Dsim_GD12763; GD12763 gene product from transcript GD12763-RB (A)
MNRLFVRRAGQHVTRSLFGPNASRLPQVTCVRDACCKDEYSLIDHKFDAIVIGAGGAGMR
AGFGLAEKGFQTAIISKLFPTRSHTVAAQGGVNAALSNMDKDDWKYHFYDTVKGSDWLGD
QNAIHYMCREAEKAVCELDMYGMPFSRKPDGKIYQRPFGGQTLDYGKGGVARRACACADR
TGHALIHTLYGQTLKHSDSCHYFVDYFVLDLIMSQGACVGCLAWKLDDGTFHRFLAKNTV
VAAGGCGRVYFSTTAGHTCTGDGNAWVSRQELPLMDMEFVQFHPTGIYGAGCLITEGVRG
EGGFFLNCKGERFMERYAPKAKDLASRDVVARAMTMEVLAGNGCGPLKDHVHLQLHHIDA
KIIKQRLPGIMVTARIFAKVDVTKEPVPVLPTVHYNMGGIPTDYKGRVVTIDENGKEQVV
KGLYSCGETSCASVHGANRLGANSLLDLIIFGRVCALDIAANSCPGDKPPQVEDKATEKS
LDNFKRLRCADGCIPTAALRMELQRTMTKHAAVFREGKLLKEGLLKVAELCEQFKDIKTT
DRTMVWNSNLVETLELQNMLANAVHIITAMENRKESRGSHAREDFKTRVDELDYGAPLAG
QKKKPFEEHWRKHTMTFALGNKGCASIKYRPVVDTTLDSSVAPIPPAPRTY

BLAST