GenomeNet

>dsi:Dsimw501_GD25325 Dsim_GD25325; GD25325 gene product from transcript GD25325-RD (EC:1.3.-.-); K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MSGIMRVPSILAKNAVASMQRAAAVGVQRSYHITHGRQQASAANPDKISKQYPVVDHAYD
AIVVGAGGAGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGGINAALGNMEEDDWKWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAFGGQSLKFGKG
GQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEDGECRGVLALNLEDGT
LHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGLPSQDLEFVQFHPTGIYGA
GCLITEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSRSMTIEIMEGRGAGPDKDH
VYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYRGQVIT
IDKDGKDVIVPGLYAAGEAASSSVHGANRLGANSLLDLVVFGRACAKTIAELNKPGAPAP
TLKENAGEASVANLDKLRHANGQITTADLRLKMQKTMQHHAAVFRDGPILQDGVNKMKEI
YKQFKDIKVVDRSLIWNSDLVETLELQNLLANAQMTIVSAEARKESRGAHAREDFKVRED
EYDFSKPLEGQQKKPMDQHWRKHTLSWVCNDNGDITLDYRNVIDTTLDNEVSTVPPAIRS
Y

BLAST