GenomeNet

>dsi:Dsim_GD25325 GD25325 gene product from transcript GD25325-RA; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MSGIMRVPSILAKNAVASMQRAAAVGVQRSYHITHGRQQASAANPDKISKQYPVVDHAYD
AIVVGAGGAGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGGINAALGNMEEDDWKWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAFGGQSLKFGKG
GQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEDGECRGVLALNLEDGT
LHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGLPSQIWIHPTGIYGAGCLI
TEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSRSMTIEIMEGRGAGPDKDHVYLQ
LHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYRGQVITIDKD
GKDVIVPGLYAAGEAASSSVHGANRLGANSLLDLVVFGRACAKTIAELNKPGAPAPTLKE
NAGEASVANLDKLRHANGQITTADLRLKMQKTMQHHAAVFRDGPILQDGVNKMKEIYKQF
KDIKVVDRSLIWNSDLVETLELQNLLANAQMTIVSAEARKESRGAHAREDFKVREDEYDF
SKPLEGQQKKPMDQHWRKHTLSWVCNDNGDITLDYRNVIDTTLDNEVSTVPPAIRSY

BLAST