GenomeNet

>dsl:Dacsa_1767 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) ribulose 1,5-bisphosphate carboxylase, large subunit (A)
MVQAQQASSGFKAGVQDYALTYYTPDYTPKDTDILAAFRVTPQPGVPPEEAGAAVAAESS
TGTWTTVWTDNLTDLDRYKGRCYDIEAVPGEENQYFMFVAYPLDLFEEGSVTNMLTSIVG
NVFGFKALRALRLEDMRIPVAYLKTFQGPPHGITVERDLLNKYGRPLLGCTIKPKLGLSA
KNYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVAEAVHKAQAETNEIKGHYLNV
TAPTCEQMLERAEFVKELDMPILMHDYLTGGFTANTTLAKWCRANGVLMHIHRAMHAVID
RQKNHGIHFRVLAKCLRMSGGDHLHSGTVVGKLEGERAITLGFVDQMREDHVEEDRSRGN
FFTQDWASMGGVFPVASGGIHIWHMPALVDIFGDDSCLQFGGGTLGHPWGNAPGATANRV
ALEACVQARNEGRSLAREGNEIIKEAARWSPELKVASELWKEIKFEYEAVDTL

BLAST