GenomeNet

>dsl:Dacsa_1769 ribulose bisphosphate carboxylase small subunit; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MTQTLLNSLFVNTGFETMKTTPKQAFYETLSYLPPLTDQQIAKQIQYMLDQGFIPAIEFE
ESPKPQDHHWTLWKLPLFDASSPQDVLNEVRECRSEYSNCYIRVVGFDNIRQCQMVSFIV
YKPDGIRY

BLAST