GenomeNet

>dsu:Dsui_2466 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] | (GenBank) ATP dependent DNA ligase-like protein (A)
MIRRLLLLLLSLGWSPLWAQSPTVPPPPLLLAETYTGQEDVAAYWVSEKLDGVRAVWDGQ
VLRFRSGRPVAAPAWFVAALPATPLDGELWAGRGHFERLSATVRRELPDDAEWRQVRYMV
FELPGGEGAFSERLQRLQALVAGARVPWLQTVEQFRLANRAQLLARLEEVRRGGGEGLML
HRADAPYVTGRSEVLLKVKPWLDAEARVVAHLPGKGRYAGMLGALRVEMPDGRRFSLGTG
FSAAERRQPPPVGALITYRYRELTATGLPRFASYWRVRQDF

BLAST