GenomeNet

>dsy:DSY1579 K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) hypothetical protein (A)
MTRQKIIILFGGQSGEHEVSLNSASSVLKAIDQEKYEIETIGIAKNGQWHWGIRPEQWQQ
DPALEGIPVILAHDPTNPRFIALDGSSLPQDGKFALIFPVLHGPFGEDGTIQGLFEMANI
PYAGSGVLGSALGMDKDRMKAVFTEAGLPQAPYITVLRTMLQKPMEQLLDNIEHSLGYPC
FVKPANLGSSVGISKARNKEELIQALQLAAEYDRKLVVEQNIVGREIELSVLGNEDAQAS
IPGEILPAKDFYDYEAKYIDTGSQLVIPAPLAPEVVRSLQEKAVAAFKAVEACGLSRVDF
FVTEGSQIYINEINTMPGFTQISMYPKLWEASGIPYTELITRLIELGFQRFRDSRSRKIS
R

BLAST