GenomeNet

>dsy:DSY1579 hypothetical protein; K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MTRQKIIILFGGQSGEHEVSLNSASSVLKAIDQEKYEIETIGIAKNGQWHWGIRPEQWQQ
DPALEGIPVILAHDPTNPRFIALDGSSLPQDGKFALIFPVLHGPFGEDGTIQGLFEMANI
PYAGSGVLGSALGMDKDRMKAVFTEAGLPQAPYITVLRTMLQKPMEQLLDNIEHSLGYPC
FVKPANLGSSVGISKARNKEELIQALQLAAEYDRKLVVEQNIVGREIELSVLGNEDAQAS
IPGEILPAKDFYDYEAKYIDTGSQLVIPAPLAPEVVRSLQEKAVAAFKAVEACGLSRVDF
FVTEGSQIYINEINTMPGFTQISMYPKLWEASGIPYTELITRLIELGFQRFRDSRSRKIS
R

BLAST