GenomeNet

>dto:TOL2_C10600 K01580 glutamate decarboxylase [EC:4.1.1.15] | (GenBank) pyridoxal-dependent decarboxylase family protein (A)
MVKIRNKQYPLVADWNTLNRVFIRPEDEIGRKTLVKYMEQILFGLHDFLNKHVGVTEEIS
LIKLAEEYTDTKINAHPQKKLADVIKDIINEIAPRAVNVASPYFIGHMTSAIPFFMVHLK
AITAALNQNVIKLETSKVLSVLEKQILAKMHRMIFNFDDHFYLEHVQNTETSLGNFTTGG
TTANLTALWVARNKCFPSKGNFESIEKNGIFEAMKTHDLEKAVVLVSKRGHYSLRKAGGV
LGLGNQNVIPIDVDANRTIDIIKLKSKIKELQANKKTKIVAIIGIAGATETGIIDPLPKL
ADICQKHGIHFHVDAAWGGPVLLSEKYCHLLKGIERADSVAIDCHKQFYMPMTSGMVYFK
DPTAMDHIVYHSSYVNRPGSVDLGIKTLEGSREANSLILDSALKIMGSKGYALMIDHGIE
TAREFAKMISQRSLFQLVTKPQLNILTYRLVPLDIQKKLETADKEERQKLNYILDDINIK
IQRIQREAGKSFVSRTRLKNSPDDYNNNVVLRSVIMNPMTNIDIINEVLDEQESIFHKLV
NE

BLAST