GenomeNet

>dto:TOL2_C40850 porA; pyruvate synthase subunit alpha (EC:1.2.7.1); K00169 pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1] (A)
MKRVLTGNNSACWGIRLSRVKLIAAYPIPTQVHIMEELSIMCKDGSLDARFLQLESESSA
LAAVIASQTTGIRSFIACSLNSLSHMHDLLYRAAGARLPIVMLTVKKSLESGGHIGSDQA
DALIQRDTGWIQMYVENNQEVLDSVIQAYRIAEKVHLPVMICYDDLFSGHVCEPVDIPGQ
DEADTFLPSYEPEFFLDPKNPKSFYSQLLPDNYMDMLYQLQTAHEKALDIIDETGKSFKK
ILGRSCGVVENIECKDAQIVLVVHGAMTCPARHILKQMRKKGQKMGVLKIRIFRPFPVTA
VQTALKGCKKVIVIDKNYSLGKGGIFADELKSAISDVPDAPLVYSYIAGLREKNIALEDI
REMINETISRDTPPRHSVWKG

BLAST