GenomeNet

>dto:TOL2_C40850 K00169 pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1] | (GenBank) porA; PorA: pyruvate synthase, alpha subunit (A)
MKRVLTGNNSACWGIRLSRVKLIAAYPIPTQVHIMEELSIMCKDGSLDARFLQLESESSA
LAAVIASQTTGIRSFIACSLNSLSHMHDLLYRAAGARLPIVMLTVKKSLESGGHIGSDQA
DALIQRDTGWIQMYVENNQEVLDSVIQAYRIAEKVHLPVMICYDDLFSGHVCEPVDIPGQ
DEADTFLPSYEPEFFLDPKNPKSFYSQLLPDNYMDMLYQLQTAHEKALDIIDETGKSFKK
ILGRSCGVVENIECKDAQIVLVVHGAMTCPARHILKQMRKKGQKMGVLKIRIFRPFPVTA
VQTALKGCKKVIVIDKNYSLGKGGIFADELKSAISDVPDAPLVYSYIAGLREKNIALEDI
REMINETISRDTPPRHSVWKG

BLAST