GenomeNet

>dvi:Dvir_GJ10771 K11424 histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43] | (RefSeq) uncharacterized protein (A)
MKLSANNTHTEMQDAGVVHTPTEATDNATAGTVVPSVVKTDAGGTLSQLNAIQRFPGNLL
LRNCINDAESATDSSEQFTEYEHHNTTDQQQTPPAARGRHRVKTLNRKRDLINLQSNLSP
KYIGYPNANSPTVPDSVDKVRTTRRRNHVLTPNRDGDSDVASPKTLLAGMHMLASGAYLS
PIDKLLIKNGANSPNSTGFEADAEDVAMMQPTRKQLKRKLKRDSKPKKKHPKETPAEVTA
KETSDHLTKDEQSHQKQAIFKIGQTLATDKPEISIKVELTEEDAPHKIFEADEQIHVKTE
LKTAEQKDIEGGQVDSILALPTATSTEMEALKSPPDIEPANNSEQSMKSPSSISLDSAKG
SSIVTDSGWPTYQVGDLYWGKLFTYCYWPCMVCPDQLGQIVGNPHTHPQRKSTDSAPGAP
VPIQVHVRFFADNGRHNWIKSENLLPFAGLKAFEELREEARIKYGPRSLKYRQMTAKQNK
QIVWRQAIEEANIVGQLPYAERMQKFYEIYENTVIHNKEKRKYTKSVRQDTSDVGSSLYD
STDNLLAKTQHAQPLKRERSSSPFSPAFSPVKHNHQKRAKRRKLSGSLEAPVGYTPLSEP
HGEKLVSPDLVNYKNPEFGQLFDAIKEYVMVHRQEEKVEKVLLAVVRNIWSLKQLQLREL
ERDLASGESELLGSARLGSERGRGVGTIKRLSNRLKTMMLRRSITPVVTPSTAAPAQIST
PESMQTERHLSENPKVRKPIGRPIDEVIEDILQLDRKYLFRGLNREPVCKYCYEPGGDIQ
RCSLNCNSWLHATCLDQQITVNTKAKKGLKAVGPAPSKPPEPLTSSSPVSEVEPTTTTST
LTKHITGDEIKQEQNKEPLVCHECASGKSNACCICHQEQLPVNSPPPSPHKESVASATAI
SEVEEPPISNKLILCCQPMCSNKFHASCCKYWPQASISNSSTRCPMHVCHTCVSDDPSGK
YQQLGSAKLTKCVKCPATYHQDSRCIPAGSRMLTVTHLICPRHNIAKADANLNVLWCYIC
VRGGELVCCETCPIAVHAHCRNIPIKTNESYICEECESGRLPLYGEIVWAKFNNFRWWPS
IILPPTEIPSNILKKPHGANDFVVRFFGTNDHGWISRRRVYLYIEGDTGDGYKSKSLMSK
RYTAGVEEATRFLKIIKDKRQEQAIGRFSGNKLYPPPYIKIKANKPVPPVRFVYNEEDLN
ICECKPGSEHPCGPESGCLNRMLYHECHPDYCHAGRQCENQLFELRKSPRLEVVYMNERG
FGLVCREPIAEGDFIIEYVGEVINHAEFQRRMAQKTRDRDENFYFLGVEKDFIIDAGPKG
NLARFMNHSCEPNCATQKWTVNCINRVGLFAIKDIPENTELTFNYLWDDLMNNGKKACFC
GAKRCSGEIGGKLKDEEVKETKIKQLPRHKGIRIHVGAPKKKAAKRSKSKHMGADNVPPT
EQPLDAAPASKEP

BLAST