GenomeNet

>dvi:Dvir_GJ11231 K01785 aldose 1-epimerase [EC:5.1.3.3] | (RefSeq) uncharacterized protein, isoform A (A)
MSVKIEEEIFGLAKNPFTKIPEMVRRFTMTNTNQMSVSVIQLGAIIQSVRMPDAYQKIED
VCLGFDDIASYVNTKAAYIGGTLGRVANRVANGEYTVGETKYELTKNFKNTYQLHGGFVG
FDSVIWEVVRKSDLGITFRHVSPDGHEGYPGNLTTTITYWLDNQNRLGVRYEAFTDKMTP
VNLSNHAYFNLAGHATGAKGLAEHTVEIASTRIIDTDDDQIPTGKFLDVDDTVFDMRLPV
LLGDRLKQFDNRLIKGYDNCFVVNEGNDTGINLVAKLVHPPSGRAMEIYSNQPGLQFYTA
NNLPDEENGDAPMIGKECTHYRKHGSFCVETEKFPDAMNQHHPEFPSVFLHPGEKYLHEV
IYKFNVEESWKCCCNNK

BLAST