GenomeNet

>dvi:Dvir_GJ11699 K11430 histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43] | (RefSeq) uncharacterized protein, isoform A (A)
MSSKEWKRLVKLEYMKIRQQKRYKRADEIKEAWIKNWDEHNHNVQDLYCESKVWQAKPYD
PPHVDCVKRAEVTSYNGSNSGPQRVPICVINAVTPIPTMYTWAPTQQNFMVEDETVLHNI
PYMGDEVLDKDGKFIEELIKNYDGKVHGDKDPSFMDDAIFVELVHALMRSHSKELEETVT
SPSAKTETPTAPKLKEEDEKTETTTSSEPTAAASSSATEDKEAVPVAVIADTKCKVEKVK
EKLPFPAPIIFQAISANFPDKGTPQELKEKYIELTEHQDPERPQECTPNIDGTKAESVSR
ERTMHSFHTLFCRRCFKYDCFLHRLQGHAGPNLQKRRYPELKTFVEPCSNSCYMLIDGMK
EKLAADSKTPPIDSCNEASSEDSNDSNSQFSNKDFNPENGKDNGIAVNSAEINSIMAGMM
NITSTQCVWTGADQALFRVLHKVYLKNYCAIAHNMLTKTCRQVYEFAQKEAAEFSFEDLR
QDFTPPRKKKKKQRLWSLHCRKIQLKKDSSSNHVYNYTPCDHAGPCDMNCSCIQTQNFCE
KFCNCSSDCQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCQACGADQFKLTKITCKNVC
VQRGLHKHLLMAPSDIAGWGIFLKEGAQKNEFISEYCGEIISQDEADRRGKVYDKYMCSF
LFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVTGDHRIGIFAKRAIQPGEELFFD
YRYGPTEQLKFVGIEREMEIV

BLAST