GenomeNet

>dvi:Dvir_GJ18147 no KO assigned | (RefSeq) uncharacterized protein (A)
MLASETFPTHHFKNSIYKPYNGASSAPDVEDLASMAKTLTTTTLSSSDAAVIDVVKTTVE
YGNPNKMLNSSVSSSSNSNNKNNNIKNTNGNVNGLASFVASHPAAEFEGFIRACVDEIIK
LAVFQGTNRSSKVVEWHEPAELRKLFDFELREKGESPDKLRQLLRETIRFSVKTGHPYFI
NQLYSGVDPYALVGQWLTDALNPSVYTYEVAPVFTLMEEQVLAEMRRIVGFPNNGHGDGI
FCPGGSIANGYAISCARYKYAPESKKNGLFNAKPLIIFTSEDAHYSVEKLAMFMGFGSEH
VRKIATNELGKMRLSDLEDQIQLCLDNNWQPLMVSATAGTTVLGAFDDLVGISELCRKHN
MWMHVDAAWGGGALMSKKYRQLLNGIERADSVTWNPHKLLSASQQCSTFLTPHAQILGQC
HSTNAAYLFQKDKFYDTSFDTGDKHIQCGRRADVFKFWFMWKAKGSKGFEAHVEQVFEMS
EYFTAKLRERPGFELVLEKPECTNITFWYVPPSLRQMERNQEFFDKLHKVAPKIKEAMIK
KGSMMITYQPLRKLPNFFRLVLQNSCLEESDMLYFLNEIEDLGQNL

BLAST