GenomeNet

>dvi:Dvir_GJ19157 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) uncharacterized protein (A)
MDQEQLNGAMRSVSINSNGLATNQNGHNGNDETDNARVLGGGGGGGGISFGLSSGNAASK
ATNAATNAATNAATNAATDAATATETATATANANVNAIQIQTSAAGASAADKKKMVHELC
QQLLLTDEQVQELCYRILHEVRRGLAKDTHPKANVKCFVTYVQDLPNGNERGKFLALDLG
GTNFRVLLIHLQENNDFQMESRIYAIPQHIMIGSGLQLFDHIAECLSNFMAEHNVYSERL
PLGFTFSFPLRQLGLTKGLLETWTKGFDCAGVVNEDVVQLLKDAIARRGDVQIDVCAILN
DTTGTLMSCAWKNHNCKIGLIVGTGSNACYVEKVDEAELFDMRDNRKPHVLINTEWGAFG
DNGALDFVRTEFDKDIDSHSINPGKQTFEKMISGMYMGELVRLVLAKMTQAGILFNGQGS
EVLFTRGLFFTKYVSEIEADEPGTYTNCRLVLEELGLSNATDGDCANVRYICECVSKRAA
HLVSAGIATLINKMDEPHVTVGVDGSVYRFHPKFHNLMVEKITQLIKPGISFDLMLSEDG
SGRGAALVAAVACREDILNSK

BLAST