GenomeNet

>dvi:Dvir_GJ20456 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] | (RefSeq) uncharacterized protein, isoform A (A)
MQKSITSFFKPKDGLPGPEKSSVPEKTKSTENISKNKIKSEDVVEEPGNENKQPPLEATG
AEKPADMPPSKITKMELNPEVTEGEGIEIYDPSLESYHPLKHAYWKAERVTPYLALARTF
QVIEETSGRLKMIDILSNFFCSVMLVSPEDLVPCVYLSINQLAPAYEGLELGVAETTLMK
AICKATGRNLAHIKSQTHLTGDLGIVAEQSRVSQRMMFRPKPLNVRGVFTKLKEIAKISG
QAKMTLVYDVFVACRLSEARFFIRSLIGKLRIGIAEQSLLTALAIALVKRNHINDCKTNK
VCDVYKDEIAETTLILKTTFCQCPNYDIIIPAILKYDIKELQERCPMHPGMPLRPMLAQP
TKGVLEVLERFSGMHITCEWKYDGERAQIHLNELGEISIFSRNSENNTPKYPDLIARSKS
FLKTDVQSYIIDSEIVAWDIERKQILPFQILSTRKRKNVDIEDIKVQVCVYIFDLLFING
VSLVTKPLSLRRKMLFEHFQEVEGQWKFATALDTNDMDEVQQFLEESIKGNCEGLMVKTL
EEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYGGFLLACYDTEN
EEYQSICKIGTGFTDDDLRLHSEFFNKHVTGSAKSYFRYDPSLEPDVWFEPVQVWEVKCA
DLSLSPIHRASIGIVDAERGISLRFPRFIRIRDDKSPENATDANQVAHMYKSQDQVRNNQ
KSSSLMDIESDFY

BLAST