GenomeNet

>dvi:Dvir_GJ20851 K01312 trypsin [EC:3.4.21.4] | (RefSeq) uncharacterized protein (A)
MRCSCRDSSQLAPDGRIVGGEVISAYYLPYQVSVRRRNSARSAYAHSCGGALLDERTVLT
AAHCVYNRQEENFLVVAGTELRAGMDGGVVSRVERLVPHELYNASITDNDIALIFVTPPF
PLDSQRKIATIEVGPELPPVGTLATVSGWGMTTEDGFGSTQLRQVQVPLVDREVCQTAYN
WRPITEGMLCAAASGGGKDACQGDNGGPLVVDNKVVGIVSFGEGCARAQYPGVYAAVPYF
QEWIAEQRAAYA

BLAST