GenomeNet

>dvi:Dvir_GJ20852 K01312 trypsin [EC:3.4.21.4] | (RefSeq) uncharacterized protein (A)
MVHALLLGLCLGLWVCAWAHPLQELDLSSPNGRIVGGYETHIALYPHQISLRRKAITAPK
NPFSHICGGSIIAEDIIATAAHCIIATVPSQYKVVAGTSRRNDSDGIIVSVSEIIMHEKY
NPSTYDNDIALLRLSSPLPLNNFTIQAIELASTDATPGAISTITGWGTTSAGGTASDQLR
AVDVPIVSNELCDEDYGGNRITAGMLCAGVRGVGGKDACQGDSGGPLIIGNKLHGIVSWG
NSCALPTHPGVYAKVFYYLDWIASNCHWSFVIRSDPFDMCRSLEQMPNRRRNMDILRFSL
MLLFALAAVAWASEVRPEARIINGSKVDIARHPYCVSLRFRRNNESAYLHECAGVIYSER
AVLTAAQCLDDLAEGTKLLVLAGANTRNGSDGLVYPVTSWSYHPNFSTITADYDIGVLVL
DTPFDLNYYGIRKIGLRPERPATGRNATVVGWGYREEWGPSSYYLEQVHVPIVSSEQCNS
IYGAGEVTERMICAGDVAQGGRDACQGDTGGPLIIDEQLVGLVSWGRGCGRPGYPTVYTY
APSLKTWIDETLEAAGAL

BLAST