GenomeNet

>dvi:Dvir_GJ21166 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) uncharacterized protein, isoform A (A)
MTIPILYYDDRSPPVRSCLMLIKMLNINVELRFVDLFKGAQFEKDFLALNPQHSVPTLVH
DELLLTDSHVILIHLVEQFDTEAGRLWPKDYAARMKVLNRLFFECSFLFRRDSDLMSEIV
RKQFANVDVAYHERKLCEAYDIMERYLDGQTYMAGDQLTLADISIVSTLSTVHLMFPVAA
ARWPQLQRWFATMQQLDAYEVNRLGVEKLRDIIEKLGKFQFPNRQL

BLAST