GenomeNet

>dvi:Dvir_GJ23225 K00693 glycogen synthase [EC:2.4.1.11] | (RefSeq) uncharacterized protein, isoform A (A)
MLRRQMSYRFEDQDSSSMALRMNRRFSRVESGTDLKDYFDRGDNASRENRWNFEVAWEVA
NKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEIEFPRGNPLLDAVNTLRS
RGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCNIGVPHLDIETNDAIILGF
MIAEFLEEFRNCAIAFSQNNDLNPPRIVAHFHEWQAGVGLIVLRTRLIEIATVFTTHATL
LGRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCMERGATHLAHVFTTVSEITGYEAEH
LLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHMDFDLDKTLYFFI
AGRYEFGNKGADIFIEALARLNAMLKHERPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQ
LRDTINNVQQAVGKRMFDTCVKGHIPSPDELLQKDDLVKIKRCMYAMQRDSMPPVTTHNV
ADDWNDPVLSSIRRCHLFNSVHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSY
YEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHISDPKSYGIYIVDRRYIGLENSVQQLS
SFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDESSAYG
SRSNLIFSRPQSEPPSPTSSRHTTPAPSLHGSDDEDSVDEETELKELGIK

BLAST