GenomeNet

>dvl:Dvul_1229 K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] | (GenBank) glycerol 3-phosphate dehydrogenase (quinone) subunit B (A)
MSDRTYDCDLVVAGTGMAGMAAALFAARRGLSVVQAGSTGEIVFASGLFDVLGVHPMAEG
RRLASPWEGMARLAADEPKHPYGVIAPSRMKDALAEFTGWLEAHGLPYRNGGDSNVRVLS
PMGTVKTSWAVPSTMWAGVEALAEKKPCLLVDFEGLREYSARQIADTVGGAWPGLRTVRV
EFPGTPMRPLLTGIMGQALELRVTREQLAEVIRPHLGDCACVGLPAILGIFHPGTVLAEM
EAMLGVPVFEIPTLPASVPGLRLKNVFEGHIGTEGVDLMLQRKVLDVHRQDGALHVSIGQ
GSVERVVRARGMILATGRFLGHGLFAERDRIRETVLDLPVHQPAGRSQWHSLDLFDPAGH
PVSRAGVVTDSSFRPVDEEGRVLHEDVRCVGTLLAHQDWMRQKCGVGLAVGSSAVAVDAF
VAQFSAG

BLAST