GenomeNet

>dwi:Dwil_GK10941 K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] | (RefSeq) uncharacterized protein (A)
MIMVRRRARPAKGPMVGATTATTDQADASAEPLSLNVTEAAMGVAAANLLDDQYFASPKR
KDCRLMKANENLTKTTIEANTEPSAGRTIGVPLATRSQTRTIENFFKANAAAKNANTNPN
PNLNPNKEQKTISATHTELALVEDVELTVEELQFDGHSTASSSHSSPAYQNEDEEHDDEV
DDQLEVEVVTNAVQISTADFQSHRSSALRDSHSSTHSSSSSSAATDNIFLQEPVLTLDID
RTPTKASSIKINKSFELANIVFSSPPSAMNACMLNGRFNQIVSLNGGGHVVPSMQLEPEA
IVPQAPIINGFDNFVDQHDSSSCDSGVACSLGTPAAAPGTTGRRRKPATPHRIVCPSPIK
TLPREIVGSGGGLSRKAAAGFKAECDPLSPRKSPRKLPTTTAAVAACKSRRRLNQPKPQA
PYHSPPLQQPPPPTSSSGTHLSNPTNDDAIVVVLDDDDEDLDGDEYEDDMGALLKAAEER
ENLNKAPTVNNNNHIKAMLKPVPPKPKVTKGGSKTKTMTQKSQPLPLPLAATNGNREMTD
FFPVRRSVRKTKTAVKEEWMRNLEQAVLEERCDGLIVRNFTGKGRGVVADRHFKRNEFVV
EYVGDLISIGDASERERRYALDENAGCYMYYFKHKTQQYCIDATVDTGKLGRLINHSRNG
NLMTKVVVIKQRPHLVLLAKDDIEPGTELTYDYGDRSKESLLHHPWLAF

BLAST