GenomeNet

>dwi:Dwil_GK11194 K10776 DNA ligase 3 [EC:6.5.1.1] | (RefSeq) uncharacterized protein (A)
MATPLQNEDNKLDTFRRICDEIASESSYLRKVERLEGFFKKGSKGTVFEGDFLLWVQFLI
PGATQRVYNLQNKALIKLFSRILNSDQNQMQLDLEQDGDVSETLRKHFAASAKLKPQTQS
KLYLQEVDELLRQLEQKTKEDDQTELLKELCKKATELDLRTFIRLIKQDLRINARARHIL
DAFGPLAYPAYQSSRDLTAIVQQFAGKAVKTQAKSPAKKLKTTTSAIQVMTPISPMLANA
CKSVEEAFKKNPAGLFGEVKYDGERVQIHKKGKEFKFFSRNLKPVMDHKIKRLTEYIPRA
FPGAGDMILDSEIILVDTETGALLPFGTLGAHKKHEYANASVCLFVFDCILYDGEDLMQL
EFRKRREILEQNIEPIKSYVQLSESQFLKTKSELAMMTAKVLQANLEGVVLKNPNGTYQP
GKRNWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGVLSIFLMGCYDPKDRLWKTVTK
VHSGLDDSTNDEIHENLMKLTTRADANKTPNWLLCKKSLVPDVLAVDPQKMPVWEITGAE
FTKSEAHTAAGVSIRFPRITRLRSDKTSKEANDLPHLLNLYEASKKNVNVDLLLANCDND
KDGLEKKLAQEKTPEKRKSLENSAKKSKKSISKEDEDSQCSSKMIKREVNKPSQKGLQYY
FKPDKIQNNVKSELKTEVKTELKTQVKSETHTAMEVDENTPKQVKSKLFSGLVAHFTKDA
TKSKQMQEFVQHGGSLTTNTQKAALAFYNTNTSVNLAHLRPLYRRRCRHLTVSWLDRSIE
TQTLQPYPLYAVLLKS

BLAST