GenomeNet

>dwi:Dwil_GK11561 K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] | (RefSeq) uncharacterized protein (A)
MALPLRNPFYRLIGKTAFRFYSKDSANSGDEEKAKYKIVMIRHGESEWNKKNLFCGWYDA
ALSENGLVEACSAGTAIRKAKLKFDIAHTSVLKRANDTLMAILLSSGHKDIPIRKTWRLN
ERHYGGLTGLNKTETAKKFGEEKVQIWRRSFDTPPPPMEEDHKYYNEIRNDPRYCENGPD
PEDFPKTESLKLTIERTLPYWNEVIVPQIREGKKIIIVAHGNSLRGVVKHLDEISDEAIM
GLNIPTGLPFVYNLDECIKPVGKIQFLGDPEMVKKAMESVANQGKAK

BLAST