GenomeNet

>dwi:Dwil_GK11930 GK11930 gene product from transcript GK11930-RA; K04441 p38 MAP kinase [EC:2.7.11.24] (A)
MAATSTRKAQKFYKLEINRTEWEVPDMYQDLQPVGQGAYGQVCKALVKNGSTTTKVAIKK
LARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPNPPNSTLYLVTHLMDADLNNII
RMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTEN
EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIME
MLGTPPDDFMKKISSESARNYILSLPPMKRRSFKRVFENANPLAIDLLEQMLELDAEKRI
TAEEALAHPYLEKYAEPSDEQTSPPYDHSFEDMDLSVEKWKDLIYKEVVNFKPPQSYAHI
WQDIK

BLAST