GenomeNet

>dwi:Dwil_GK13498 K11427 histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43] | (RefSeq) uncharacterized protein (A)
MATPQVKDLVLRSPAGSSDVITFAWPLQVGHGQDKHDNGFDIIDTIKFVCDELPSISSAF
EEINLHQIDTACYKTMTNLVDRFNKAVDSIVALEKGTSLPAERLNKFAHPSLLRHILQLV
YNAAVLEPDKLNQYEPFSPEVYGETSYELVQQMLKHVTVSKEDTFIDLGSGVGQVVLQMA
GSFPLKTCIGIEKADTPARYAERMDLFFRQYMGWFGKRFCEYKLIKGDFLVDEHREKITS
STLVFVNNFAFGPTVDHQLKERFADLRDGARVVSSKSFCPLNFRITDRNLSDIGTIMHVS
EIPPLKGSVSWTCKPVSYYLHVIDRTKLEQYFQRLKTKGGDHDHVGTVRTTRDRAKREAN
IGSGSAGSHHNNNHNNNHNNNNNNHQQRGAEREQSNGGTSSRHQSQSPANVNASGAMGSG
LSSGTGGGSGGNNGGVASKTTRQQAQQQQQQQQQQQRSLDMDSTSDSDGDATTGNGGNTT
TTTNTTSTSNGGGPMTRKVWSDWCSSKGKSSQSDEEENNNTNGGGSATASGRQSRATTNT
TIQKKRKKLTRKAAIASKSAAAAQRATAEAAAVAAAAATSKDSSSKEDQPPRAASTGPGI
GGGRKGRLKKGARGRKCLKIAGLDVLHKQTVLSTTGDANAKKLPAAPGTVDQQLTSLLTE
NMDHNELDIPLAPQHTPYALQILLDVFRSQYMSMIEHMKSSAYLPQVQKQIAQEQERMAR
LKNRASQLDKQIKVLIDDSVALLKIRMNELGISVNSPNDLIAQAKEIVGRHKDLQHTVSK
MRNEVTFYEGEQKLMLSKQLKHLPEYQKLFGNSLNGKVKMEMPQELSETTAQELVLKEIA
NTLSQRKKLYAQVSTIEQETSVLQKTAEERTTAAALLAQGTNISLAASSSSNSGSTNNPA
PPPPPLPPASSSSSSVAVAATSLAAAAPSASSLSVSVPNCKMTTTTNSSSTTNNHVKSAR
RSREHRARSQEWPEVPEVGKIQESNPEVLAQKIVETCRQIEAGHYQVNGKNKTNAEMNQQ
TPPPPPATTTSTAAVKSMYKDSTLMPAPKQQQQQQQQQQMQLLSSILPKCELPGLLSSSI
LNSASSSSSSSSSSIMGRSAVSSIKQESPKVANFEDRLKSIITTALNEDQEQRSKASTTA
MDSLPPPTPTQSPAPKRSKPQQQHHHQQQHQQQSQMHPLHNIITVSTQGLMHLNANTTIS
PITPPLPGPAAGATASTAPPPPANLPYGAGVYGGKNHGGKYHHQMPIKESKYSPAARHGQ
HAQLTPTPTSSSSHMANLYGPTGPGVGSASSANANPPPPAAAAAANDLSYGQRRRGTVSA
SSYEHFMVQQQQQQQQHALMLAAAAHAAQRQQMRTEEQPQPQQHRLPQHHLLHHQQQQQQ
QHHSHPAHHHPNEFKTPAENLQLQRSSSREQLMLVEQQQAPPSHIELLPRSSSANSLDYG
SNASSTGGGYRVRPPSRPSSNSSQPDYTQVSPAKMALRRHLSQEKLNQPPQATSTPPTGQ
QTPSSGGGKTIGDLVNGEIERTLEISQQSIINVAVNMSTTGVGAAAAAHFMDRAFPNERL
LINLNAQRPERVNIRPIQDDHHAGGSSTDQPTNYSQQQQQQQQATASGSNLATLAHVAYA
QKSQRPMSTSSASASAINPSRSGRDYQPVALPRAEMKGCIEAYFHEEQQQQQQQQKTKNA
AVGGVGRASRLNGANPPLEGLAASLQDHVRARKYKEENEERQRRAAAAASSSSANAASSS
SSSGGGPSTELNPHYAHQAPPAHTYLHMQQQQQQHHQPNSHQHLNGTPHKVEIGIKRTSP
LAPHQQPPRPAKLAHFETQQQQPHLYANGQVVLPPPPAAHEATTTPSPTPSSSSSSCGAG
GGGGGRRSKLLIDPPLLMSPEINSLMVDERSLPLSVHHNHQQQQQQQHLHHNHHHPHAHQ
VAQQQQQAHRLPLHGQATLNMNATRGNSSSSSSSSNNNNNANAADDDDVIAADDESHWQH
RVSSGFDRLVAFASTELDKTRRSIDGDTVPASISCNTSPDSGITTHSSSNSDAARTFLST
SSSSSQLELPPSSGSSSSNQSLYNSQQAHNQQQHLHHGAQQLAQPQLPQPHHLNAADHLS
DSSMKSTASSSLAAGTSLKTISPVDPSAIESPPLSDVGLPRTPSPSAVSVATPPPIAANA
GPPQTMPMANELRIPLKYQRKSKIGSEKHYKKKFCERNWEYDCEDELLAYSNLSAPATAA
DAAGNGPGVMDSSGGGGGGGLNANPKSGKSPKDKSSPHQQQQHQQQQHHHKSSKFRPKGK
DWDWSLDSRSQTGELMPTPNTTSGSHNNNSSSATTTSN

BLAST