GenomeNet

>dwi:Dwil_GK19666 K02358 elongation factor Tu | (RefSeq) uncharacterized protein (A)
MSRFLPKLWGYANVPLRQKYCNSLVRLLSTVSSPSPSVRDRAHCNVGTIGHVDHGKTTLT
AAITKIQSKKGLAEFLSYEQIDRAPEEKARGITINACHIGYATNERTYAHTDCPGHADYI
KNMISGASQMDGAILVVAATDGQMPQTREHLLLAKQVGIQRIIVFINKADLVDEEVLELV
EIEMREMLTDFGFDGVNSPVICGSALLALREDNESPFGVKAIEELLKQCDSYIPTPQRDI
VAPFILPIDNAFTVPGRGTVVVGTIKRGTIVRNSDADLLGFNQNLKTSVSDIQIFRKSVP
QALAGENVGALLRGIKISAVERGMLLCATGSEDISNHFEGSMYLLSRSEGGRVKPMLSKY
IQQLFSMTWNVPARIDIVPSEAMLMPGEHGQVRVTLLRKMVMTPGQAFTIRENGATVATG
MITQRLPSLDLPKNKLSKASVVC

BLAST