GenomeNet

>dwi:Dwil_GK20355 K00310 pyrimidodiazepine synthase [EC:1.5.4.1] | (RefSeq) uncharacterized protein (A)
MSNGRHLAKGSPPPEVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTEKPDW
LYDKNPQGKVPALELVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIES
FNPVLGAFFKASDGGDMEPFWSGLDVYEKELGRRETLFFGGEQTGILDYMIWPWLERLEL
LKLQRGEDYNYDKQRFPQLTQWLERMKRDAAVMAFYMEAEVQAEFLRTRSAGKPNYNLLV
KDA

BLAST