GenomeNet

>dwi:Dwil_GK21544 K01176 alpha-amylase [EC:3.2.1.1] | (RefSeq) uncharacterized protein, isoform A (A)
MIFTKTLLALAFVAIANAQFSPNYESGRNGMVHLFEWKWDDIAAECENFLGPYGYAGLQV
SPVNENAVKSGRPWWERYQPISYKLTTRSGNEEQFASMVKRCNAVGVRTYVDVVFNHMAA
DGGTYGTAGSTADPSTKSFPGVPFSSLDFNPTCSISNYNDANQVRNCELVGLRDLNQGNS
WVQDKVVEFLNHLIELGVAGFRVDAAKHMWPSDLGVIYGRLNNLNTAHGFSSGAKPYIFQ
EVIDMGGEAISKTEYTGIGAVTEFRHSDSIGKAFRGKDQLQYLVNWGTAWGFAASDRSLV
FVDNHDNQRGHGAGGADVLTYKVPKQYKMASAFMLAHPFGVPRVMSSFSFDDTDQGPPTT
DGTNIASPGFNSDMSCSGGWVCEHRWRQIYNMVAFRNAADGAELQNWWDNGSNQISFSRG
NKAFVAFNNDNYDLNSSLQTGLPAGTYCDVISGVKNGSSCTGKSVTVGSDGRASISISSS
ADDGVLALHVNAKL

BLAST