GenomeNet

>dwi:Dwil_GK21994 K01312 trypsin [EC:3.4.21.4] | (RefSeq) uncharacterized protein (A)
MLKFVVLLSLAACVLGGTIPEGLLPQLDGRIVGGYETSIEDHPYQVSLQRSGSHFCGGSI
YNHDIVVTAAHCLQSIEAHELKVRVGSTYWRSGGSVHSVKSFRNHEGYNSRTMVNDIAII
RIESDLSFRSSIKAIAMADSNPRNGATAVVSGWGTTESGGSTIPDHLLAVDLKIVDREEC
ASGKFSYGRKIKDTMICAYAEHKDACQGDSGGPLVSGSRLVGVVSWGYGCGDVRYPGVYA
DVAHFHEWIEKTADEL

BLAST