GenomeNet

>dwi:Dwil_GK22213 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) uncharacterized protein, isoform A (A)
MSGIMRVPSILAKNAVASMHRVAAVASQRSYHITHGRHQATAANPDKISKQYPIVDHSFD
AIVVGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTIAAQGGINAALGNMEEDDWKWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAFGGQSLKFGKG
GQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEDGECRGVLALNLEDGT
LHRFRAQNTVMATGGYGRAFFSCTSAHTCTGDGTAMVARQGLPSQDLEFVQFHPTGIYGA
GCLITEGCRGEGGYLINSKGERFMERYAPVAKDLASRDVVSRSMTIEIMEGRGVGPEKDH
VYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGIPTNYRGQVIT
IDKDGKDVIVPGLYAAGEAASSSVHGANRLGANSLLDLVVFGRACAKTIAEENKPGAPAP
KLKDNAGEASVANLDKLRHANGQITTADLRLKMQKTMQGHAAVFRDGPILQKGVAKMQEV
YKEFKDVKVVDKSLIWNSDLVETLELQNLLANAQMTIVGAEARKESRGAHAREDFKTRID
EYDYSKPLEGQEKVPVEKHWRKHTLSWVCNDNGDVQLDYRNVIDTTLDNEVSTVPPAIRS
Y

BLAST