GenomeNet

>dwi:Dwil_GK24391 no KO assigned | (RefSeq) uncharacterized protein (A)
MLASENFPTHHFKESIFKPYNATTSAANAAAAATVEDLANVAKTLTSKSTTSSSVASDAA
ATVSLMGAVDIETARKMLANNNVNINNNNNNNINNNNSKDTAEFESFLRGCIDEIIKLAV
VEGTNRSSKVVEWHEPSELRQIFDFQLREKGESQDKLRELLRETIRFSVKTGHPYFINQL
YSGVDPYALVGQWLTDSLNPSVYTYEVAPVFTLMEEEVLAEMRRIVGFPDNGLGDGIFCP
GGSIANGYAISCARYKYAPESKKNGLFSGKPLIIFTSEDAHYSVEKLAMFMGFGSEHVRK
IATNEVGKMRLSDLEQQIQLCLDNNWQPLMVSATAGTTVLGAFDDLVGISELCRKHNMWM
HVDAAWGGGALMSKKYRHLLNGIERADSVTWNPHKLLAASQQCSTFLTRHQQILGQCHST
NATYLFQKDKFYDTSYDTGDKHIQCGRRADVFKFWFMWKAKGSEGLRAHVEQVFRMSEYF
TQQVRERPGFELVLESPECTNISFWYIPPSLRHMERNQEFYDKLHKVAPKIKEGMIKKGS
MMITYQPLRRLPNFFRLVLQNSCLEESDMLYFLNEIESLGHQL

BLAST