GenomeNet

>dwi:Dwil_GK24998 K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] | (RefSeq) uncharacterized protein (A)
MTDFVELLNSMSTTFNSDCATTTAEGGTLLNLDLAEDKTLKWRNLANNQFACKDKEKKQQ
PPTTTQTTSKGSDAIIDKNEDPASLEAAEQSTPAVTEQSDVTSEKVSSELLEEEIEDNVK
ELLADVIDAAAVKVEEEEKAAAVAATAKIATESEEGAKAAATTTASIAELADPPKTSFNE
AKQPATEVPADGNDNAPTATTNTPNEVTAAAVDADVDVDVDANATASASVEIKIEETSRN
AASVDSNDDRIKTETETQTKQEQISPGSNTRRLRRTPRPTDTPTTTPTPLEEPQVDGGDI
RTEVRPAKEEEEIESPIESNELNEVKKEPEKCLASVDGIGIGDDVDAAATVSSTSSTTPT
EPPVVATVVAPPPPPKRGRGRAKKIKLDVELPTNELIDGENAYGDETMATAISPTVVVER
KQPGRKRKLPEEQQEAALIASELATLVVKTENQELEVSEIAPSGSGVDPKRTRRSVRLGN
RHPADPIVNATWSEEVKTEPSVGGTSGADLVTTLSELPMPVLDEKTPPKKRGRKAKIPPT
VKPNESQLASTTTNHHSGQPLTNGNKRSTPTTTTSSSSSNVAGLGGSGELQLPKRSKRRI
KPTPKILENDELRCEFETKHIERMTHWETAGADSDSHFETPQQSFSGGGGGGAGSNSSTS
RQKSEKSDGSGFDVGGQHPAGTSAIKKRLFSKSQRDIENSGAALVAKSKVKPCPNVDKFL
SDIKAAKLNANRSPEERKLNKKQLRKLAKQKEKHLKHLGLRRNNSEDASDDDSSNTDNEE
FVPATPVQVGKPSLTLRLRNAAPKEQQVPTTSAAAAATASQKAQHPSANSVKLNRRVGVR
TGVQSAAAAAAAAAMQSPLEPDQLHSLNSSILAAAELNDTDAIPTTSNSSIKVKSSKFIC
LCQKSSQYYARNAPDSSYCCAIDNIDEQKIGCCNELSAEVHNLLRPSQRVGYMILCDDHK
KRLQSHNCCAGCGIFCTQGKFVLCKQQHFFHPDCAQRFILNSPFEGQQLLQSNNSNKFHS
PMLVLKCPHCGLDTPERTSTVTMKCQTLPVFLPTQKSKIKPAKLTTSAHLAQFAAGRSNS
TVTASKSSTTGRGRPASSANASNTNATSTSAGAAAGAGATGKSNGIRGGKATATTAAVNA
TSNSHNSGAAGGHTITFEQLIPDSVLNVVLRGHVVSASGRVTTEFTSRDMYYAVQNDDLE
RVAEILAADYNVLAPMREYPGTCLHLVAHSGTLQMAYLLLCKGASSQDFVNVVDSELRTA
LMCAVMNEKCDMLNLFLQCGADVAIKGPDGKTSLHIAAKMGNVEATQLIVDSYRASRNIS
NFLSFIDAQDEGGWTAMVWAAELGHTDIVSLLLNHGADPNICDNDNNTVLHWSALHNDGL
ETITVLLQAGADCNVQNVEGDTPLHIACRHSVTRMCIALIANGADLMIKNKAEQLPFDCI
PNEESECGRTVGFNMQMRSFRPLGLRTRVVCADASNGREARPIQAVRNELTMSEHEDEAD
TLMWPDFKYITNCIILQNSVQIDRRVSQMRICSCLDSCSSDLCQCNGASSQNWYTAESRL
ISDFNYDDPAVIFECNDVCGCNQLSCRNRVVQNGTRIPLQIVECEDPAKGWGVRALANVP
KGTFVASYTGEILTAPEADRRTDDSYYFDLDNGHCIDANYYGNVTRFFNHSCEPNVLAVR
VFYEHQDYRFPKIAFFACRDIDSGEEICYDYGEKFWRNEQRANNGCKCLTSVCKYAGRLA
ATSTNPSPMDREGFDGGDLLVSSAPPDEDFDVKA

BLAST