GenomeNet

>dwi:Dwil_GK25319 K01077 alkaline phosphatase [EC:3.1.3.1] | (RefSeq) uncharacterized protein (A)
MILHLLLFGELTTGTRLRHEPVSLLNDDLGPYWEERNASYWLQQAQRQLIQRLERFRNAR
GIGDGPLDSRVAKNIILFLGDGLSMSTLTAARILKGQREGFSGEECQLAVEQFPFSGLSK
TYCINKQTADSACSATAYLAGVKTSGGTVGQSGDGFNVEPITQWAQREGKVTGVVTTTRL
TDASPAGTYAHVQNRAEELEIARQLVEDEPGRGMKVILGGGLGKFVSERRDDRDLLEQWL
TDNPDGCFARNLEDLRDCRHGNGSLLGVFGDNHLDYHLAANKEQPRLSEMTAMAIERLSQ
HPKGYFAFIEGGRIDHGHHETRAGYALDEMLEFDAAIEMAINMTDPHDTLIVVTADHAHT
LSLSGYARRGTSILGLDKTQTDVDGVPYSILNYAIGKWQSLNKEGKRENPAKTLSKTSYF
PSYIHGRKGVHSGEDVAIFAQGPQSHLFSGVMEQNLLPHLMGYAACLGQGLTLCNETPD

BLAST