GenomeNet

>dya:Dyak_GE10618 K01360 proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94] | (RefSeq) uncharacterized protein (A)
MAAATCSWLLAPFLLLHWATAGAGGGAGGLGAGLSGPSVFTSSFLVRFRRGVDNAFAHDV
ADKYGFDNLGPLVGADGHEYHFKHRTLPHARTRRSLTHTRALKSHPAVHTAVQQPGFKRV
KRGLRPAVPAIHGMKFDLKVGEANRIDEEPTDPYFPMQWYLKNTGQNGGKVRLDLNVQAA
WAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTR
CAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGP
TDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISI
NSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAG
VFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAG
AMVTLSKQWHAVPPRYHCEAGELTQPQAIVMGRSLFWEIKTDACKGSDTEVNYLEHVQAV
ISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKL
EARFNSPQTRHGNLLEWSLVLHGTKEAPYRTLHPSSPHSKLAIVKKAHEDKKMK

BLAST