GenomeNet

>dya:Dyak_GE11418 K11421 histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43] | (RefSeq) uncharacterized protein (A)
MSGASAAMDCAESSGITVVDDQETPAPREKTCGSPVVEGENSLESTVSAEKEGQAAKDVE
MEDLTLEDPPQTEAIDAPGSTRKQPPDGGMTPDEHGTGGDESEDPKEENKEDVSIDIASS
PVLVAVDSDSSVELIESPVKSPSLDESAKDPPKSDTVDEAAAVEAKEAEELTDRSIDLIS
SPTSESTPEKDEGIKKQEQQKNEQDPDDSTKETEASGMEVDQDVEDSTDENKIEETSKEQ
KPVSSMEIEELPIVDKKDDVLEVELEKGTVPKAAEDEQLNDLPSDGDVFYDKDCVNCNCK
KLYKQYVLANMATLNFYQVVRKTSKQQFLCMGCHDTAMDLYEEYAGQLLAKQPLLLKDFH
QDHADFVALDSSDEEEEEKPPEKSDFSKNKLQFIEEELEDAIKNVLNKVDFKVQLSWSKT
ILQAKADHLERQFALADVELEKVQSTADKMHCALYNSCPVAHKHLPALDIEPNVGDYVHQ
VPPAGEIVRPPIQLGETYYAVKNKAIASWVSIKVIEFTESTSINGNTMKSYKIRYLNTPY
QMIKTVTAKHIAYFEPPPVRLTIGTRVIAYFDGTTLSRGKDKGVVQSAFYPGIIAEPLKQ
ANRYRYLIFYDDGYTQYVPHRDVRLVCQASEKVWEDVHAASRDFIQKYVEKYSVDRPMVQ
CTRGQSMNTESNGTWLYARVIDIDCSLVLMQFEGDKNHTEWIYRGSLRLGPVFRETQNTM
NSSSSQQMRVPRRTEPFIRYTKEMESSSKVNQQMRAFARKSSASGQNVALAAAASSSASS
AGGRTNAAGASTSNSASAVRHLNNSTIYVDDENRPKGHVVYFTAKRNLPPKMYKCHECSP
NCLFKIVHRLDSYSPLAKPLLSGWERLVMRQKTKKSVVYKGPCGKSLRNLAEVHRYLRAT
ENVLNVDNFDFTPDLKCLAEYSIDPSIVKDTDISKGQEKMAIPLVNYYDNTLPPPCTYAK
QRIPTEGVHLNLDEEFLLCCDCEDDCSDKSKCACWQLTVAGVRYCNPKKPIEEIGYQYKR
LHEHVPTGIYECNSRCKCKKNCLNRVVQFSLEMKLQVFKTSNRGWGLRCVNDIPKGAFIC
IYAGHLLTETMANEGGQDAGDEYFADLDYIEVAEQLKEGYESEVDHSDPDAEEDNGGPDA
EDDDDFRPNYHYQRKIKRTSRSNSTQSSELDSQERAVINFNPNADLDETVRENSVRRLFG
KDEAPYIMDAKTTGNLGRYFNHSCNPNLFVQNVFVDTHDLRFPWVAFFSAAHIRSGTELT
WNYNYEVGVVPGKVLYCQCGAPNCRIRLL

BLAST