GenomeNet

>dya:Dyak_GE13524 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (RefSeq) uncharacterized protein (A)
MLQYLVVSLALCATICSAAQTRNMPIQAIAYLIGPVQSDNTQVKGNVTFTQNDCGQNVHV
RVQLEGLKEGKHGFHIHEKGDLTNGCLSMGAHYNPDKVDHGGPDHEVRHVGDLGNLEVNS
SGIIDVTYTDPVITLTGKMAVIGRGVVVHELEDDLGLGNHTDSKKTGNAGGRIACGVIGI
NSDVDEWPCRDGGAGALRYSFSILTVIVALIMARSLD

BLAST