GenomeNet

>dya:Dyak_GE13731 K00699 glucuronosyltransferase [EC:2.4.1.17] | (RefSeq) uncharacterized protein (A)
MQIRLLFSLLLAGTLYSQLKSTEGSKILAVYAFPGKSHFMMHTALIRELVESGHQVTMVT
AFTLEKEKLGSNYTEILIEPVYDFWHDVKLNFGAQHLFELTRMTNYDFLKMLEIIGLKTT
EHALRQPKVQALINAEQKDGVFDLLLAEQFYQEAFLALAHLYKIPVVTTSTLGYENHMSQ
MMGLITPWSFVPHGFMPFTDRMSFLERVKNSYASFYEDMDRLLNYFPKMDAVTREFFGPV
LAEVPKVKHMEREISVMLLNSHAPLTTARPTVDAMVPVGGMHIYPPKPLPADMQAFLDGA
TEGAIFFSLGSNVQSKDMPVEMLRLFLQVFGSLKQRVLWKFEDESIRQLPENVMVRKWLP
QADILAHRNVKVFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLNMNKAVLGGYAISLHFQ
SITEEILRHSLNHLIHNATYKENVQRVSDIFRDRPQEPRKSAVYWIEYVIRHRGAPHMRS
AGLDLNWFQFYLLDVIAFVAIIALAGIMALSLAIRLLMGSNKKHKKAKQN

BLAST