GenomeNet

>dya:Dyak_GE16147 K10777 DNA ligase 4 [EC:6.5.1.1] | (RefSeq) uncharacterized protein (A)
MSVDIASTIKFRDICGLFEKLKASKKVANKEELLKSYYESFCRHRESFRRQTGLNDDQPE
NGVSSFYSVLRLLLPGADTGRDTYGLQITALGRLYIRVLQLPTDSSDAIRLQHRTGNMYR
DYGDVVYSVLKPRCFNPPSDLRLNHIHEMLDTIANEDTEVKQQQLIRFTEQASPEEQKWL
IRLLLKSLGLGIGEQKIFGVLHPKAQDIYQRCSDLGHVCNLLADRTTDLDASTSKDSKAA
VKFVNLNSVIRPFHQIRPMLCERFPGDIQELMQSDVLYLETKMDGERFQLHIDRGRFMYI
SRNGVDYTKNFGHSYDHGTLTPKLRGLLPLGLESIILDGEMMVWDTNQLRFREKGENTDV
KSLKPEGSWQPCFVVYDLLYFNGQSLLDHTYIQRAYKLQKLIVEQSGVLQLMRARKIGSV
KEFNELFQQALDSHAEGIVLKKQASRYQPGVRLGGGWYKDKADYIKGLITEFDVLIIGAF
YNRKRTFVDSFLLGVLQPAPPGSSNRPEVFSIGVVANNTKQRAVLNHTLKPHWHDVVNEP
PPLWYHYKPKDRSGCPDLWIEPHNSVILQVKAADLAPNGAFFTRKSLHFPRTEMKRDDKP
WNECMTLKEFNNLCDGSLAIKKLNKRQLRLEDVTTKRKQMRMTPSERSRLALAVYEKRYV
ANPSTSSSKLFDGLSFCILSGSAGRHSKHQLQELAVKNGGCIVENPLPNDPKCFCIAGDE
TFLVRRLILQKPRTCDIVRMEWLLRVCQKQELELRPRDIIAATEPLQQDLAECFDRHGDS
YSKDIANVQELQDLLQDIHLTAENVVGISASKVNALEDRLLDGKKNLNMFRHLNAYFYSP
QGDELARLLFMQNGGRIVDDSDPQLNLGFICMSSDIDNDHFEHWLRNHSKLSADKVVNSA
WIHQSHREGLLLPMQCFV

BLAST