GenomeNet

>dya:Dyak_GE16999 K09188 histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43] | (RefSeq) uncharacterized protein (A)
LVTEASSKSAELLPPPPYEMASAPISNVTISISTKQAAPKELQMKPKAVAMSLPMEQGEE
SLPEQAEPPPHSEQGATVAGVAPHSGGSLVSAQWTSNHIEGGAATTKIPFKPGEPQKRKL
PMHPQLDEKQLQQQAEIPISNSLPTTPTGQGTPDKVQLISAIASYVKKSGGPNEAQPIQN
QSQGQAQMQAQMQATMQGHLSGQIPGQISGHAAGQMPAQMHLQVQHQLHMAVHPQQQQQQ
QQLHQNQQQNATIPVPVGGQGAVPIPGPTMEPKAGDQRKRRKREVQKPRRTNLNAGQAAG
ALKDLTGPLPAGAMVQLAGMPPGTQYIQGAASGTGHVITSTGQGVTLGGVGASSGTGSSP
MLKKRVRKFSKVEEDHDAFTEKLLTHIRQMQPLQVLEPHLNRNFHFLIGSNETSGAGSPG
SMSSTASAGSSSAGGGKLKGGSRGWPLSRHLEGLEDCDGAILGRYGRVHLPGIPSLYDSE
RFGGSRGLVGGSAGTRSPSPADSAGAEKMIPMSSIQNDFYDQEFSTHMERNPRERLVRHI
GAVKDCNLETVDLVESEGVAAWAAFPRLTRYPGLILLNGNSRCHGRMSPVALPEDPLTMR
VPVSPLLRSCGEELRKTQQMELGMGPLGNNNNNNYQQKNQNVILALPATASENIAGVLRD
LANLLHLAPALTCKIIEDKIGNKLEDQFMNQDDDKHIDFKRPLSQVSHGHLRKILNGRRK
LCRSCGNMVHATGLRVPRHSVPALEEQLPRLAQLMDMLPRKAVPPPFVYFCDRACFARFK
WNGKDGQAEAASLLLQPAGGSTAKSSNGDSPGSFGTSSTAPAEMVVKQEPEDEAEKTPGV
PGTPTNIPVQRKCIVKCFSADCFSTDSTSTELEFEGTAGAGTGTGPVNNTVWETETSGLQ
LEDTRQCVFCNQRGDGQADGPSRLLNFDVDKWVHLNCALWSNGVYETVSGALMNFQTALQ
AGLNQACSACHQLGATIKCFKSRCNSLYHLPCAIREECVFYKNKSVHCSVHGHAHAGIAM
GAGGGNTTGAGVGGSVADNELGSLVVHRRVFVDRDENRQVATVMHYSELSNLLRVGNMTF
LNVGQLLPHQLEAFHTPHYIYPIGYKVSRYYWCVRRPNRRCRYICSIAEAGCKPEFRILV
QDAGDKEPEREFRDSSPSAVWQQILQPITRLRKVHKWLQLFPQHISGEDLFGLTEPAIVR
ILESLPGIETLTDYRFKYGRNPLLEFPLAINPSGAARTEPKQRQLLVWRKPHTQRTAGSC
STQRMANSAAIAGEVACPYSKQFVHSKSSQYKKMKQEWRNNVYLARSKIQGLGLYAARDI
EKHTMIIEYIGEVIRTEVSEIREKQYESKNRGIYMFRLDEDRVVDATLSGGLARYINHSC
NPNCVTEIVEVDRDVRIIIFAKRKIYRGEELSYDYKFDIEDESHKIPCACGAPNCRKWMN

BLAST