GenomeNet

>dya:Dyak_GE18686 no KO assigned | (RefSeq) uncharacterized protein (A)
MLASENFPTHHFKESIFKPYSTSGDDLASATPLTAAAALVATTSSPADSSSAVAFETASK
MLATNNNNNNNITSSKDDLSSFVASHPAAEFEGFIRACVDEIIKLAVFQGTNRSSKVVEW
HEPAELRQLFDFQLREKGESQDKLRELLRETIRFSVKTGHPYFINQLYSGVDPYALVGQW
LTDALNPSVYTYEVAPLFTLMEEQVLAEMRRIVGFPNGGQGDGIFCPGGSIANGYAISCA
RYRHSPESKKNGLFNAKPLIIFTSEDAHYSVEKLAMFMGFGSEHVRKIATNEVGKMRLSD
LEEQVKQCLENNWQPLMVSATAGTTVLGAFDDLAGISELCKKYNMWMHVDAAWGGGALMS
KKYRHLLSGIERADSVTWNPHKLLAASQQCSTFLTRHQQVLAQCHSTNATYLFQKDKFYD
TSFDTGDKHIQCGRRADVFKFWFMWKAKGTQGLEAHVEKVFRMAEFFTAKVRERPGFELV
LESPECTNISFWYVPPGLREMERNREFYDRLHKVAPKVKEGMIKKGSMMITYQPLRQLPN
FFRLVLQNSCLEESDMVYFLDEIESLAQNL

BLAST