GenomeNet

>dya:Dyak_GE18695 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) uncharacterized protein (A)
MWIPAAVLLLVGLARSESPPDATLERFLNETSQQLAVIYDQAVLAQLLNELRGPNDLVAL
LEIEVTDDKLMKYVRTLTTRKAKFKRLGLGDARQRRLLDKIPQLGYEALSGRDLKLVYAL
ASSMSDNYHNVKLCAYKQPGNCTLRLIPEVQSIVQGSRDLEEIEYYWFEWRSRTGLATRS
QFVDFMDLYKKTAQLNGYPRAEDYWFRSLELAGREAMTLLDRIMHGLRPLFLQFHAHVRG
SLRKMHGEHLVPRNRPYPQHLAEVFIGNAFRRVQAEWYVDLPSPEIGLANITQELHRRGL
STTQRVFWNVAEYFRALGFPQLENSLWTYAQKVSSDDDDRCWHKAWRYYALPRTNFTYCP
LNDEERFFNMFEAQSDLQYYRAAAVQPTLLQEEPFPNFSDAIGKCFSMAASSPRFLRKLG
ILRENKWKELPARLNRLYIQGLRVVFLLPVFYVLDRYRVEVLAGHIKADDNEAYWRFTEH
YTGAAAPTKRTNEQFDVPAKLLMEVDDQYASNFLSIVLQFQLLKHFCTKTGQFEMGNPRK
PLDLCDLSDQRGIGEVLKQAMSLGSSVHYREVLKVLLGEPEISVDGLLAYFQPLHDWLQH
QNQENNLEVGWT

BLAST