GenomeNet

>dya:Dyak_GE20651 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) uncharacterized protein, isoform A (A)
MSLNPNGYKLSERTGKLTAYDLMPTTVTAGPETREFLLKVIDVLLDFVKATNDRNEKVLD
FHHPEDMKRLLDLDVPDRALPLQQLIEDCATTLKYQVKTGHPHFFNQLSNGLDLISMAGE
WLTATANTNMFTYEIAPVFILMENVVLTKMREIIGWSGGDSILAPGGSISNLYAFLAARH
KMFPNYKEHGSVGLPGTLVMFTSDQCHYSIKSCAAVCGLGTDHCIVVPSDEHGKMITSEL
ERLILERKAKGDIPFFVNATAGTTVLGAFDDINTIADICQKYNCWMHIDAAWGGGLLMSR
KHRHPRFTGVERADSVTWNPHKLMGALLQCSTIHFKEDGLLISCNQMSAEYLFMTDKQYD
ISYDTGDKVIQCGRHNDIFKLWLQWRAKGTEGFEQQQDRLMELVQYQLKRIREQSDRFHL
ILEPECVNVSFWYVPKRLRGVPHDAKKEVELGKICPIIKGRMMQKGTLMVGYQPDDRRPN
FFRSIISSAAVNEADVDFMLDEIHRLGDDL

BLAST