GenomeNet

>dya:Dyak_GE24529 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) uncharacterized protein (A)
MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAGEQFKPEYLKINPQHTIPTLHDNG
FALWESRAIMVYLVEKYGKDDKLFPKDVQRQALINQRLYFDMGTLYKSFSEYYYPQIFLK
KPANEENYKKIEVAFEFLDTFLEGQTYSAGEDYSLADIAFLATVSTFEVAGFDFKRYANV
ARWYEQTKKLTAGWEENWAGCQEFRKYFDN

BLAST