GenomeNet

>dya:Dyak_GE26056 K11433 histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43] | (RefSeq) uncharacterized protein (A)
MDGSETAPNDDYEHPDELEYILESVLMPSDDSEEFKCLADDYNSVLLNHCRCKGACENSE
VCPHGGQYEFTGDGSELLLRKSANPVIECNDLCKCCRNTCSNRLVYLGPRKHLEIFDSPV
YGSKGLRTTVNIPKGGYICEYAGELLTVTEAKRRLQANEELNLMNYVLVLNEYTSDKKQQ
VTIVDPSRRGNIGRYLNHSCEPNCHIAAVRIDCPIPKIGIFAAKDIAATEELCFHYGGEG
QFKKVTGGKPCLCGASKCTGFMPNTTIDG

BLAST