GenomeNet

>dze:Dd1591_0236 K02170 pimeloyl-[acyl-carrier protein] methyl ester esterase [EC:3.1.1.85] | (GenBank) bioH protein (EC:3.1.1.1) (A)
MESLYWHTEGEGTCELVMLHGWGMNSQVWNSIVMRLAPHFRLHRVDLPGYGQSQGFGVMS
LADMAQQVLAQAPARAVWLGWSLGGLVASQAALSAPERVSALITLASSPCFEERDGWPGI
RPQVLSGFQQLLSDDFFGTIERFLALQTLGTENARKDARSLKAALSGQPAPTTEVLNAGL
GILRDTDLREPLSTLTMPFLRLYGALDGLVPRKVAALMDEQYPHSTSVVIPKAAHAPFIS
HPEVFVEHVVGFVGKISTFDK

BLAST