GenomeNet

>eas:Entas_3431 glycoside hydrolase family protein; K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] (A)
MSVFPQGFLWGGALAANQSEGAYREGGKGLTTVDMIPHGANRLAVKVGKEKRFSLRDDEF
YPSHEAIDFYHRYKEDIALMAEMGFTVFRTSIAWSRLYPNGDEPLPNKEGIAFYRAVFEE
CKKYNIEPLVTLCHFDVPMHLVTEYGSWRNRKMVDLFARYARTCFEEFNGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENEDQVKYQAAHHELVASALATKIAHEVNPENQVGCMLAGG
NFYPYSCKPEDVWMALEKDRENLFFIDVQARGSYPAYSARVFREKGVVIVKEPGDDQLLK
NTVDFVSFSYYASRCASADMNAQNTNAANIVKSLRNPHIEVSEWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDVIEANGEINDDYRISYLREHIRAMGDAIEDGVPLMGYTTWG
CIDLVAASTGEMSKRYGFVYVDRDDAGNGTLDRKRKKSFWWYKKVIASNGTDLT

BLAST