GenomeNet

>ebi:EbC_12300 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase family protein (A)
MLKVWGRKTSSNVQAVMWCIAELGLPCERVDIGHKYGGNDTAEFLAMNPNGTVPVIRDGE
GEPLWETGAILRYLANRYADRTFWPADIAQRAAVDKWAEWAKINVAHSFTAPLFWRVVRT
AEKDRDYPAIAAALSVLNSKLAIAEAQLNQHAYLAGNELTLADIQFGHLLFRYFDIELAR
TPFPAVEAYYQRLQLRPAFVEHVMVSYEDLRVT

BLAST